PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00913.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 348aa    MW: 38711.1 Da    PI: 6.5172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00913.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
  Rsa1.0_00913.1_g00011.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding49.69e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Rsa1.0_00913.1_g00011.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.46965IPR017930Myb domain
SuperFamilySSF466891.76E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001673.13E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007177.7E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.41266116IPR017930Myb domain
PfamPF002494.8E-1467112IPR001005SANT/Myb domain
CDDcd001673.39E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRPPCCEKN GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
ESGGEDNDGF TSSTTISQKQ HQSSNKGQWE RRLQTDINMA KQALCEALSL DKKTSSTLSP  180
SSLSTPVIIP QNTPSFSSAL LDRCYDPSSS SSSTTTTTTS NATNPYQSGV YASSAENIAR  240
LLQDFMKDTP KPLTLTSSST VSETGPLASA TSEEGGEGFE QSFFSFNSME ETQNLTQETS  300
FFHDQERKPA KTMDQDSGLI SQGSLSLLEK WLFDENMVGM SLGQEAMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261411627128MYB TRANSFORMING PROTEIN
1mse_C5e-26141164105C-Myb DNA-Binding Domain
1msf_C5e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531670.0AK353167.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-26-J10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623250.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D3BFS40.0A0A0D3BFS4_BRAOL; Uncharacterized protein
STRINGBra029258.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-172myb domain protein 96